Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g035940.0.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 677aa    MW: 75633.6 Da    PI: 5.5787
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g035940.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53
                        +R++f+ +q++eLe++F+ +++p++++++eLA+k +++++qV++WFqN+R 
                        89************************************************7 PP

               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                         la++a++el+k+a ++ep+Wv+      e++n +e+ ++f +  +     +++ea r sg v +++ +lve l++ + qW e ++    k+
                         7899************************************88777999999**************************.************* PP

               START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                          t +vis+g      g+l l+ aelq +s +vp R+  f+R+++++ +++w+ivdvSvd  ++ +++ ++ ++++lpSg++i+++sng+sk
                         *****************************************************************9************************* PP

               START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                         vtw+eh+++++  ++ l+r+l++ gl +ga++w++ lqrq e
                         ***************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.6132585IPR001356Homeobox domain
SMARTSM003896.6E-132789IPR001356Homeobox domain
PfamPF000463.7E-153080IPR001356Homeobox domain
CDDcd000862.96E-143086No hitNo description
PROSITE profilePS5084839.771199435IPR002913START domain
SuperFamilySSF559611.22E-25201430No hitNo description
SMARTSM002341.8E-35208432IPR002913START domain
PfamPF018526.6E-45209431IPR002913START domain
CDDcd088751.03E-96216431No hitNo description
SuperFamilySSF559612.2E-5458644No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240735.10.0PREDICTED: homeobox-leucine zipper protein HDG1-like isoform X1
TrEMBLK4C4W40.0K4C4W4_SOLLC; Uncharacterized protein
STRINGSolyc06g035940.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-177HD-ZIP family protein